Host taxon 9606
Protein NP_061194.2
interleukin-20 precursor
Homo sapiens
Gene IL20, UniProt Q9NYY1
>NP_061194.2|Haemophilus ducreyi 35000HP|interleukin-20 precursor
MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.87 | 5.87308485305039 | 0.0018 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)