Host taxon 9606
Protein NP_037410.1
interleukin-17C precursor
Homo sapiens
Gene IL17C, UniProt Q9P0M4
>NP_037410.1|Haemophilus ducreyi 35000HP|interleukin-17C precursor
MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.99 | 2.98920656591702 | 0.00072 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)