Host taxon 9606
Protein NP_001230468.1
interleukin-15 receptor subunit alpha isoform 3
Homo sapiens
Gene IL15RA, UniProt Q13261
>NP_001230468.1|Haemophilus ducreyi 35000HP|interleukin-15 receptor subunit alpha isoform 3
MSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.68 | 1.67665298587366 | 6.8e-6 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)