Host taxon 9606
Protein NP_000576.1
interleukin-15 isoform 1 preproprotein
Homo sapiens
Gene IL15, UniProt P40933
>NP_000576.1|Haemophilus ducreyi 35000HP|interleukin-15 isoform 1 preproprotein
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.12 | 2.11793521560837 | 1.7e-8 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)