Host taxon 9606
Protein NP_001010844.1
interleukin-1 receptor-associated kinase 1-binding protein 1
Homo sapiens
Gene IRAK1BP1, UniProt Q5VVH5
>NP_001010844.1|Haemophilus ducreyi 35000HP|interleukin-1 receptor-associated kinase 1-binding protein 1
MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.87 | -0.869929455948697 | 0.0014 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)