Host taxon 9606
Protein NP_660292.1
interferon alpha-inducible protein 27-like protein 1
Homo sapiens
Gene IFI27L1, UniProt Q96BM0
>NP_660292.1|Haemophilus ducreyi 35000HP|interferon alpha-inducible protein 27-like protein 1
MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAILQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.98 | 4.9830716197802 | 0.00055 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)