Host taxon 9606
Protein NP_009110.2
insulin-like peptide INSL6 precursor
Homo sapiens
Gene INSL6, UniProt Q9Y581
>NP_009110.2|Haemophilus ducreyi 35000HP|insulin-like peptide INSL6 precursor
MPRLLRLSLLWLGLLLVRFSRELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDFKRLKEKRSSLVTKIY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.33 | 1.33121768675438 | 0.0024 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)