Host taxon 9606
Protein NP_997276.1
insulin growth factor-like family member 3 precursor
Homo sapiens
Gene IGFL3, UniProt Q6UXB1
>NP_997276.1|Haemophilus ducreyi 35000HP|insulin growth factor-like family member 3 precursor
MRPRCCILALVCWITVFLLQCSKGTTDAPVGSGLWLCQPTPRCGNKIYNPSEQCCYDDAILSLKETRRCGSTCTFWPCFELCCPESFGPQQKFLVKLRVLGMKSQCHLSPISRSCTRNRRHVLYP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.06 | -2.0559692131185 | 7.9e-10 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)