Host taxon 9606
Protein NP_001002915.2
insulin growth factor-like family member 2 isoform a
Homo sapiens
Gene IGFL2, UniProt Q6UWQ7
>NP_001002915.2|Haemophilus ducreyi 35000HP|insulin growth factor-like family member 2 isoform a
MRFSVSGMRTDYPRSVLAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.59 | -2.58562851456667 | 2.9e-13 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)