Host taxon 9606
Protein NP_940943.1
insulin growth factor-like family member 1 precursor
Homo sapiens
Gene IGFL1, UniProt Q6UW32
>NP_940943.1|Haemophilus ducreyi 35000HP|insulin growth factor-like family member 1 precursor
MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.65 | -1.64964293746701 | 0.036 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)