Host taxon 9606
Protein NP_001035091.1
homeobox protein MOX-1 isoform 3
Homo sapiens
Gene MEOX1, UniProt P50221
>NP_001035091.1|Haemophilus ducreyi 35000HP|homeobox protein MOX-1 isoform 3
MGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.59 | 0.590890180804948 | 0.042 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)