Host taxon 9606
Protein NP_001159396.1
homeobox protein EMX2 isoform 2
Homo sapiens
Gene EMX2, UniProt Q04743
>NP_001159396.1|Haemophilus ducreyi 35000HP|homeobox protein EMX2 isoform 2
MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGKSMVSEPKNKVQKAEAGGRRLRFATKEKRDAPY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.22 | -1.22140670915623 | 0.013 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)