Host taxon 9606
Protein NP_001925.2
homeobox protein DLX-4 isoform b
Homo sapiens
Gene DLX4, UniProt Q92988
>NP_001925.2|Haemophilus ducreyi 35000HP|homeobox protein DLX-4 isoform b
MKLSVLPPRSLLAPYTVLCCPPDSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.45 | -2.44541135423058 | 9.6e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)