Host taxon 9606
Protein NP_001013721.2
histone H3.3C
Homo sapiens
Gene H3-5, UniProt Q6NXT2
>NP_001013721.2|Haemophilus ducreyi 35000HP|histone H3.3C
MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.11 | 1.11338012213061 | 0.0003 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)