Host taxon 9606
Protein NP_003510.1
histone H2B type 1-L
Homo sapiens
Gene H2BC13, UniProt Q99880
>NP_003510.1|Haemophilus ducreyi 35000HP|histone H2B type 1-L
MPELAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.98 | 0.984791599517216 | 0.0057 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)