Host taxon 9606
Protein NP_001299582.1
histone H2B type 1-K
Homo sapiens
Gene H2BC12, UniProt O60814
>NP_001299582.1|Haemophilus ducreyi 35000HP|histone H2B type 1-K
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.91 | 0.912621050915585 | 1.5e-7 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)