Host taxon 9606
Protein NP_002096.1
histone H2AX
Homo sapiens
Gene H2AX, UniProt P16104
>NP_002096.1|Haemophilus ducreyi 35000HP|histone H2AX
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.65 | 1.64542936852549 | 6.2e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)