Host taxon 9606
Protein NP_002097.1
histone H2A.Z
Homo sapiens
Gene H2AZ1, UniProt P0C0S5
>NP_002097.1|Haemophilus ducreyi 35000HP|histone H2A.Z
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.62 | 1.61577491607041 | 9.5e-9 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)