Host taxon 9606
Protein NP_542163.1
histone H2A type 1-H
Homo sapiens
Gene H2AC12, UniProt Q96KK5
>NP_542163.1|Haemophilus ducreyi 35000HP|histone H2A type 1-H
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.56 | 1.56293907716726 | 3.2e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)