Host taxon 9606
Protein NP_612638.3
histidine triad nucleotide-binding protein 3
Homo sapiens
Gene HINT3, UniProt Q9NQE9
>NP_612638.3|Haemophilus ducreyi 35000HP|histidine triad nucleotide-binding protein 3
MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.38 | -0.375328955228245 | 0.017 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)