Host taxon 9606
Protein NP_005331.1
histidine triad nucleotide-binding protein 1
Homo sapiens
Gene HINT1, UniProt P49773
>NP_005331.1|Haemophilus ducreyi 35000HP|histidine triad nucleotide-binding protein 1
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.03 | 1.03102545585039 | 7.7e-5 | 31213562 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)