Bacterial taxon 233412
Protein WP_010944600.1
heme utilization protein HutZ
Haemophilus ducreyi 35000HP
Gene hugZ, UniProt Q7VND3
>WP_010944600.1|Haemophilus ducreyi 35000HP|heme utilization protein HutZ
MSVTNRQEVLQNRLGPEIQELKQDIQTLVLSTVDSEGNPNVSYAPFVINSGEYQVLISTIARHARNLIEVPKVSLMLIDDESKSRQIFARRRLTFDATARLIEREGEEWESGLAALKARHGNLIDELANMKDFKLFSFKPTHGLFVKGFGKAFEVSPDDLVNIVHLDEGHQTDE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●○○○○ -0.8 | -0.797550186546222 | 0.018 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)