Host taxon 9606
Protein NP_060312.2
heme transporter HRG1
Homo sapiens
Gene SLC48A1, UniProt Q6P1K1
>NP_060312.2|Haemophilus ducreyi 35000HP|heme transporter HRG1
MAPSRLQLGLRAAYSGISSVAGFSIFLVWTVVYRQPGTAAMGGLAGVLALWVLVTHVMYMQDYWRTWLKGLRGFFFVGVLFSAVSIAAFCTFLVLAITRHQSLTDPTSYYLSSVWSFISFKWAFLLSLYAHRYRADFADISILSDF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.75 | -0.747246934367513 | 0.00024 | 31213562 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)