Host taxon 9606
Protein NP_653218.1
heat shock protein beta-6
Homo sapiens
Gene HSPB6, UniProt O14558
>NP_653218.1|Haemophilus ducreyi 35000HP|heat shock protein beta-6
MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.74 | -0.73532046476074 | 0.02 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)