Host taxon 9606
Protein NP_001528.1
heat shock factor-binding protein 1
Homo sapiens
Gene HSBP1, UniProt O75506
>NP_001528.1|Haemophilus ducreyi 35000HP|heat shock factor-binding protein 1
MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.82 | 0.815611278442458 | 4.9e-6 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)