Host taxon 9606
Protein NP_061856.1
H/ACA ribonucleoprotein complex subunit 1
Homo sapiens
Gene GAR1, UniProt Q9NY12
>NP_061856.1|Haemophilus ducreyi 35000HP|H/ACA ribonucleoprotein complex subunit 1
MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.07 | 1.07185314927974 | 0.00088 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)