Host taxon 9606
Protein NP_000849.1
guanylate kinase isoform b
Homo sapiens
Gene GUK1, UniProt Q16774
>NP_000849.1|Haemophilus ducreyi 35000HP|guanylate kinase isoform b
MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.77 | 0.767190427175667 | 0.0061 | 31213562 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)