Host taxon 9606
Protein NP_001185683.1
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
Homo sapiens
Gene GNGT2, UniProt O14610
>NP_001185683.1|Haemophilus ducreyi 35000HP|guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.11 | 3.10762956520041 | 4.1e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)