Host taxon 9606
Protein NP_005265.1
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 precursor
Homo sapiens
Gene GNG5, UniProt P63218
>NP_005265.1|Haemophilus ducreyi 35000HP|guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 precursor
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.61 | 1.6089043972379 | 7.3e-10 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)