Host taxon 9606
Protein NP_061329.3
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 precursor
Homo sapiens
Gene GNG12, UniProt Q9UBI6
>NP_061329.3|Haemophilus ducreyi 35000HP|guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 precursor
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCIIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.67 | -0.668870076083708 | 0.0043 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)