Host taxon 9606
Protein NP_004117.1
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 precursor
Homo sapiens
Gene GNG11, UniProt P61952
>NP_004117.1|Haemophilus ducreyi 35000HP|guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 precursor
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.08 | 1.07809894082001 | 7.2e-9 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)