Host taxon 9606
Protein NP_001243749.1
GTP-binding protein Rit1 isoform 3
Homo sapiens
Gene RIT1, UniProt Q92963
>NP_001243749.1|Haemophilus ducreyi 35000HP|GTP-binding protein Rit1 isoform 3
MTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.72 | 0.715525037853318 | 0.00024 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)