Host taxon 9606
Protein NP_060064.2
GTP-binding protein Di-Ras2
Homo sapiens
Gene DIRAS2, UniProt Q96HU8
>NP_060064.2|Haemophilus ducreyi 35000HP|GTP-binding protein Di-Ras2
MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.4 | -2.40034360286531 | 0.0021 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)