Host taxon 9606
Protein NP_660156.1
GTP-binding protein Di-Ras1
Homo sapiens
Gene DIRAS1, UniProt O95057
>NP_660156.1|Haemophilus ducreyi 35000HP|GTP-binding protein Di-Ras1
MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.73 | -0.731095880390725 | 0.046 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)