Host taxon 9606
Protein NP_001502.1
growth-regulated alpha protein precursor
Homo sapiens
Gene CXCL1, UniProt P09341
>NP_001502.1|Haemophilus ducreyi 35000HP|growth-regulated alpha protein precursor
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 8.18 | 8.17637148964796 | 8.6e-22 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)