Host taxon 9606
Protein NP_006696.1
growth arrest and DNA damage-inducible protein GADD45 gamma
Homo sapiens
Gene GADD45G, UniProt O95257
>NP_006696.1|Haemophilus ducreyi 35000HP|growth arrest and DNA damage-inducible protein GADD45 gamma
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.29 | 1.28534099717743 | 0.0037 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)