Host taxon 9606
Protein NP_001288701.1
glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 isoform 2 precursor
Homo sapiens
Gene GPIHBP1, UniProt Q8IV16
>NP_001288701.1|Haemophilus ducreyi 35000HP|glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 isoform 2 precursor
MKALGAVLLALLLFGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.16 | -2.16119306795386 | 0.00058 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)