Host taxon 9606
Protein NP_001177942.1
glutathione S-transferase omega-2 isoform 2
Homo sapiens
Gene GSTO2, UniProt Q9H4Y5
>NP_001177942.1|Haemophilus ducreyi 35000HP|glutathione S-transferase omega-2 isoform 2
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.3 | -1.29604633487277 | 7.5e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)