Host taxon 9606
Protein NP_001177931.1
glutathione S-transferase omega-1 isoform 2
Homo sapiens
Gene GSTO1, UniProt P78417
>NP_001177931.1|Haemophilus ducreyi 35000HP|glutathione S-transferase omega-1 isoform 2
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.31 | 2.31258341874663 | 3.5e-13 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)