Host taxon 9606
Protein NP_000839.1
glutathione S-transferase Mu 2 isoform 1
Homo sapiens
Gene GSTM2, UniProt P28161
>NP_000839.1|Haemophilus ducreyi 35000HP|glutathione S-transferase Mu 2 isoform 1
MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.65 | -1.65381876584365 | 7.2e-7 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)