Host taxon 9606
Protein NP_000572.2
glutathione peroxidase 1 isoform 1
Homo sapiens
Gene GPX1, UniProt P07203
>NP_000572.2|Haemophilus ducreyi 35000HP|glutathione peroxidase 1 isoform 1
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.85 | 1.84517601848907 | 4.2e-11 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)