Bacterial taxon 233412
Protein WP_010944332.1
glutaredoxin, GrxA family
Haemophilus ducreyi 35000HP
Gene grxA, UniProt Q7VP11
>WP_010944332.1|Haemophilus ducreyi 35000HP|glutaredoxin, GrxA family
MLVEIYGCLSCLYCVRAKQLAEKMAIELADFEFKFIDMIAEGISKQDLAVRVGKAVDTVPQIFLDDQAVGGCTEFQQLVKQKFDIEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●○○○ -1.01 | -1.01194641870559 | 0.0041 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)