Host taxon 9606
Protein NP_001276876.1
glutamate-rich protein 2 isoform 2
Homo sapiens
Gene ERICH2, UniProt A1L162
>NP_001276876.1|Haemophilus ducreyi 35000HP|glutamate-rich protein 2 isoform 2
METVNEPETGEVSKDAVIVKQEKNNEYCLQDIDDKLSESAEDDGEDDTNDEDDDEDSNPKKNTQAPLELMAEFLRAEMAREYQLAKKLCQMILIYEPENPEAKEFFTLIEEMLLMEKTQNHEQDGENSDEDSSGESKGESDEELSDESSDEGEDGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.88 | -0.876731389479756 | 0.008 | 31213562 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)