Host taxon 9606
Protein NP_001229557.1
glucose-fructose oxidoreductase domain-containing protein 1 isoform 2
Homo sapiens
Gene GFOD1, UniProt Q9NXC2
>NP_001229557.1|Haemophilus ducreyi 35000HP|glucose-fructose oxidoreductase domain-containing protein 1 isoform 2
MTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQDATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.51 | -0.509927826454854 | 0.015 | 31213562 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)