Host taxon 9606
Protein NP_001035532.1
gastrotropin isoform 1
Homo sapiens
Gene FABP6, UniProt P51161
>NP_001035532.1|Haemophilus ducreyi 35000HP|gastrotropin isoform 1
MKTVTMMMVVEMQALTQVLRAVLSACTWVSRKGDLQRMKQTHKGKPPSSMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.29 | 2.29235200102449 | 0.01 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)