Host taxon 9606
Protein NP_009216.1
gamma-aminobutyric acid receptor-associated protein-like 2
Homo sapiens
Gene GABARAPL2, UniProt P60520
>NP_009216.1|Haemophilus ducreyi 35000HP|gamma-aminobutyric acid receptor-associated protein-like 2
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.65 | 0.647372475565347 | 0.013 | 31213562 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)