Host taxon 9606
Protein NP_001129489.1
G1/S-specific cyclin-D3 isoform 1
Homo sapiens
Gene CCND3, UniProt P30281
>NP_001129489.1|Haemophilus ducreyi 35000HP|G1/S-specific cyclin-D3 isoform 1
MNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.37 | 1.37284792940608 | 3.6e-6 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)