Host taxon 9606
Protein NP_056529.1
G0/G1 switch protein 2
Homo sapiens
Gene G0S2, UniProt P27469
>NP_056529.1|Haemophilus ducreyi 35000HP|G0/G1 switch protein 2
METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.57 | 2.56698374707074 | 3.4e-6 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)