Host taxon 9606
Protein NP_076423.2
FUN14 domain-containing protein 2
Homo sapiens
Gene FUNDC2, UniProt Q9BWH2
>NP_076423.2|Haemophilus ducreyi 35000HP|FUN14 domain-containing protein 2
METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQESGPSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.68 | 0.683247573796743 | 0.00057 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)