Bacterial taxon 233412
Protein WP_010945025.1
formate dehydrogenase accessory protein FdhE
Haemophilus ducreyi 35000HP
Gene fdhE, UniProt Q7VM84
>WP_010945025.1|Haemophilus ducreyi 35000HP|formate dehydrogenase accessory protein FdhE
MSIRILPENEIKPSASAFEIPPLLFANPKNLYTRRAKRLRELAKNNPLRDYLEFAAHLVDIQLTLLETAPIGNYAEKLTAYLTENQGQKPLNKQQFARDEKWLELLLALIKQCKPYATGAILTTLEFLEKASYAELNNLADHLLNERYEQVSPDQSVFIWLALSLYWTQLAQQLPRHTQAEIGERHTCPVCGSAPITSVIHLDKTQGLRYLHCALCESEWNMTRAQCSNCDESGDLNYWSFDTVEAPIKAESCGDCHSYLKVLYQEKDPYVEPLADDLASLMLDIEMEQKGFVRSGLNPFLFSIE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●●○○ -2.01 | -2.01120879330533 | 1.8e-9 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)